PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.PZ90V
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 447aa    MW: 48984.4 Da    PI: 6.6127
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.PZ90VgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.7e-32249304156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Araip.PZ90V 249 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 304
                  68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.355246306IPR017930Myb domain
SuperFamilySSF466895.02E-17246307IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-28247307IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26249304IPR006447Myb domain, plants
PfamPF002497.7E-7251302IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MASPSELSLD CKPHSYSMLL KSFGDHNNSN SNDQEQNQSY KIEEFLSRLE EERLKIDAFK  60
RELPLCMQLL TNAMEASRQQ LQAFNQGTTR PVLEEFIPIK HSEISEKEAP SSMNMMMSDN  120
KANWMTSAQL WSQSSQEGTT SAATPPPSKD ADNNNNIGFM SMSPNKHRNG GSGGAFLPFS  180
KERRNNNSCT LGGELALASP DKEMLIMDDD NNNNNKRDHS SSNDQGKGTT TSSATPPPST  240
TTTSQTHRKA RRCWSPDLHR RFVNALQMLG GSQVATPKQI RELMKVDGLT NDEVKSHLQK  300
YRLHTRRPSP SPQPGAPAPQ LVVLGGIWVP PEYATAAGAP AAIYGAHHPA SHAPPPHYCA  360
ATPMPQEFYT AAPPQPLLPP PPPPHHLHMY KAAGQNSSPE SEVGGCGERS ESIEDGKSES  420
SSWKGESEGE RKGLNEESNC SDITLKF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016182248.10.0PREDICTED: uncharacterized protein LOC107624273
TrEMBLV7C9V60.0V7C9V6_PHAVU; Uncharacterized protein
TrEMBLI1K1C40.0I1K1C4_SOYBN; Uncharacterized protein
STRINGGLYMA05G08150.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.19e-82G2-like family protein